
Active Ingredient(s): Lepirudin
FDA Approved: * March 6, 1998
Pharm Company: * BERLEX
Category: Blood Thinner (Anticoagulant)

* This drug may consist of multiple approval dates, manufacturers, or distributors. If applicable, they would be listed below under "NDC Database Records".

Refludan Overview

Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin[1] derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution ...

Read more Refludan Details
Details May Include Instructions, Side Effects, Interactions, Etc. Drug monograph is from Wikipedia. All text is available under the terms of the GFDL (GNU Free Documentation License). Source:

Recent Refludan Forums:

Be the first to start a discussion about this drug.

Possible Dosages for this and Related Drugs:

  • Injection: 50mg, 50mg/vial
Note: Above list includes dosages for all drugs with the same combination of active ingredients.

NDC Database Records for Refludan: (1 result)

Sorted by National Drug Code
  • 50419-150 Refludan 50 mg/ml Intravenous Powder by Bayer Healthcare Pharmaceuticals Inc.

Other drugs which contain Lepirudin or a similar ingredient: (1 result)