Lepirudin

Category: Blood Thinner (Anticoagulant)



Lepirudin Overview

Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin[1] derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution ...

Read more Lepirudin Details
Details May Include Instructions, Side Effects, Interactions, Etc. Drug monograph is from Wikipedia. All text is available under the terms of the GFDL (GNU Free Documentation License). Source: en.wikipedia.org/wiki/Lepirudin

Recent Lepirudin Forums:

Be the first to start a discussion about this drug.

Possible Dosages for this and Related Drugs:

Lepirudin
  • Injection: 50mg, 50mg/vial
Note: Above list includes dosages for all drugs with the same combination of active ingredients.

Other drugs which contain Lepirudin or a similar ingredient: (1 result)